PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G060800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 335aa    MW: 36366.8 Da    PI: 6.2642
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G060800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  Sevir.6G060800.1.p 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                        788*******************************************97 PP

2Myb_DNA-binding55.71.1e-1767111147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rgr+T+eE++l++ +++  G++ W+ Ia++++ gRt++++k++w+++
  Sevir.6G060800.1.p  67 RGRFTAEEEKLIISLHAIVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                         89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466897.86E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.5E-151461IPR001005SANT/Myb domain
CDDcd001671.25E-111761No hitNo description
PROSITE profilePS5129425.93262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2565116IPR009057Homeodomain-like
SMARTSM007172.1E-1766114IPR001005SANT/Myb domain
PfamPF002493.5E-1667111IPR001005SANT/Myb domain
CDDcd001675.54E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TAEEEKLIIS LHAIVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPA  120
VSTTTTSSSV TAATSPPCST AASDAAAALG HHLQTPFSAA EHQLDALISQ SCLALPSKLS  180
GGGQNSPPAP PLPPHCPFFM FDTSSVSPPS SLTSPVAQLA QHPFLTFAAA SMDAPGYQLP  240
PLVDGMGMGM AAMDCGLGEE SRGNNSQAAA AMANGGGWQQ QKQEEQQLGQ DQWDEESAQH  300
LLMWDDDQEL TPSNLEAMES GAHSLLFMGP NDHE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794130.0HF679413.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB7 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972853.10.0PREDICTED: myb-related protein Zm38
TrEMBLC5YGT51e-173C5YGT5_SORBI; Putative uncharacterized protein Sb07g003320
STRINGSb07g003320.11e-173(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60323757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.14e-84myb domain protein 103